Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-33 (TSPAN33)

This Recombinant Human Tetraspanin-33 (TSPAN33) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Tetraspanin-33, Tspan-33, Penumbra, hPen, Proerythroblast new membrane

UniProt

Q86UF1

Expression Region

1-283

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSD KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSR ERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLG GVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD279/PD-1 Antibody[EH12.2H7]
E-AB-F1229C-01 20 Tests

FITC Anti-Human CD279/PD-1 Antibody[EH12.2H7]

Sign In for Pricing
View Details
FITC Anti-Human CD279/PD-1 Antibody[EH12.2H7]
E-AB-F1229C-02 100 Tests

FITC Anti-Human CD279/PD-1 Antibody[EH12.2H7]

Sign In for Pricing
View Details
FITC Anti-Human CD279/PD-1 Antibody[EH12.2H7]
E-AB-F1229C-03 2x 100 Tests

FITC Anti-Human CD279/PD-1 Antibody[EH12.2H7]

Sign In for Pricing
View Details
Mupp1 (MPDZ) Human Gene Knockout Kit (CRISPR)
KN419952 1 Kit

Mupp1 (MPDZ) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific,  30nm
GAF-451-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific, 30nm

Sign In for Pricing
View Details
FITC Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227C-01 50 Tests

FITC Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details