Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-33 (TSPAN33)

This Recombinant Human Tetraspanin-33 (TSPAN33) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Tetraspanin-33, Tspan-33, Penumbra, hPen, Proerythroblast new membrane

UniProt

Q86UF1

Expression Region

1-283

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSD KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSR ERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLG GVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha Adducin (ADD1) (NM_001119) Human Over-expression Lysate
LC420118 20 µg

alpha Adducin (ADD1) (NM_001119) Human Over-expression Lysate

Sign In for Pricing
View Details
DYKDDDDK Tag ( FLAG ) Mouse Monoclonal Antibody [A2-A4]
M1403-2 100 µL

DYKDDDDK Tag ( FLAG ) Mouse Monoclonal Antibody [A2-A4]

Sign In for Pricing
View Details
Polystyrene AM COOH
H50056003.100G 100 g

Polystyrene AM COOH

Sign In for Pricing
View Details
Azo Rubine (Technical Grade)
TRC-A965140-50G 50 g

Azo Rubine (Technical Grade)

Sign In for Pricing
View Details
TACO1 (NM_016360) Human Over-expression Lysate
LC402545 20 µg

TACO1 (NM_016360) Human Over-expression Lysate

Sign In for Pricing
View Details
SH2D4B (NM_001145719) Human Over-expression Lysate
LC428983 20 µg

SH2D4B (NM_001145719) Human Over-expression Lysate

Sign In for Pricing
View Details