Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-33 (Tspan33)

This Recombinant Mouse Tetraspanin-33 (Tspan33) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Tetraspanin-33, Tspan-33, Penumbra, mPen, Proerythroblast new membrane

UniProt

Q8R3S2

Expression Region

1-283

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARRPGVPAAYGDEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTIVFLLQLAAGILGFVFSD KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYRDWSQNMYFNCSEDNPSR ERCSVPYSCCLPTPNQAVINTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLG GVALGLAIPQLVGILLSQVLVNQIKDQIKLQLYNQQHRADPWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Saline Peptone Water ISO 10 mL (Culture media in glass tubes/bottles)
26486 100/Pack

Alkaline Saline Peptone Water ISO 10 mL (Culture media in glass tubes/bottles)

Sign In for Pricing
View Details
SLC37A1 Adenovirus (Mouse)
44162054 1.0 mL

SLC37A1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse VEGF (164aa)
Z200575 10 µg

Recombinant Mouse VEGF (164aa)

Sign In for Pricing
View Details
ARHGDIA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV674311 1.0 µg DNA

ARHGDIA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Homovanillic acid
M18398-01 Inquire

Homovanillic acid

Sign In for Pricing
View Details
Homovanillic acid
M18398-02 500 mg

Homovanillic acid

Sign In for Pricing
View Details