Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-33 (Tspan33)

This Recombinant Mouse Tetraspanin-33 (Tspan33) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Tetraspanin-33, Tspan-33, Penumbra, mPen, Proerythroblast new membrane

UniProt

Q8R3S2

Expression Region

1-283

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARRPGVPAAYGDEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTIVFLLQLAAGILGFVFSD KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYRDWSQNMYFNCSEDNPSR ERCSVPYSCCLPTPNQAVINTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLG GVALGLAIPQLVGILLSQVLVNQIKDQIKLQLYNQQHRADPWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntenin 1 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2544921 100 µL

Syntenin 1 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Mouse Monoclonal Destrin Antibody (OTI2F7) [Alexa Fluor 405]
NBP2-71669AF405 0.1 mL

Mouse Monoclonal Destrin Antibody (OTI2F7) [Alexa Fluor 405]

Sign In for Pricing
View Details
Neu (Phospho-Tyr1248) Polyclonal Polyclonal Conjugated Antibody
orb1630454 100 µL

Neu (Phospho-Tyr1248) Polyclonal Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Beclin 1 Rabbit pAb, Pacific Blue conjugated
orb2886984 100 µL

Beclin 1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Copper Oxidized Human LDL
MBS3908031-01 0.5 mg

Copper Oxidized Human LDL

Sign In for Pricing
View Details
Copper Oxidized Human LDL
MBS3908031-02 5x 0.5 mg

Copper Oxidized Human LDL

Sign In for Pricing
View Details