Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-33 (Tspan33)

This Recombinant Mouse Tetraspanin-33 (Tspan33) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Tetraspanin-33, Tspan-33, Penumbra, mPen, Proerythroblast new membrane

UniProt

Q8R3S2

Expression Region

1-283

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARRPGVPAAYGDEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACL AVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTIVFLLQLAAGILGFVFSD KARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYRDWSQNMYFNCSEDNPSR ERCSVPYSCCLPTPNQAVINTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLG GVALGLAIPQLVGILLSQVLVNQIKDQIKLQLYNQQHRADPWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2) (APC)
128547-APC 100 µL

Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2) (APC)

Sign In for Pricing
View Details
FCGR3A antibody
orb254709-01 50 μL

FCGR3A antibody

Sign In for Pricing
View Details
FCGR3A antibody
orb254709-02 100 µL

FCGR3A antibody

Sign In for Pricing
View Details
Anti-IRF5 Antibody Picoband® Fluoro647 Conjugated
A00958-1-Fluoro647 100 µg/Vial

Anti-IRF5 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Mouse Protein ajuba, JUB ELISA Kit
MBS9334604-01 48 Well

Mouse Protein ajuba, JUB ELISA Kit

Sign In for Pricing
View Details
Mouse Protein ajuba, JUB ELISA Kit
MBS9334604-02 96 Well

Mouse Protein ajuba, JUB ELISA Kit

Sign In for Pricing
View Details