Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction beta-1 protein (Gjb1)

This Recombinant Mouse Gap junction beta-1 protein (Gjb1) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Gap junction beta-1 protein, Connexin-32, Cx32

UniProt

P28230

Expression Region

1-283

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tph2 / Tryptophan 5-hydroxylase 2 Recombinant Protein
R2229r 1 Each

Rat Tph2 / Tryptophan 5-hydroxylase 2 Recombinant Protein

Sign In for Pricing
View Details
Rat IgG2a isotype control-InVivo
C00074-1mg 1 mg

Rat IgG2a isotype control-InVivo

Sign In for Pricing
View Details
EHD3 Rabbit pAb, PerCP-Cy7 conjugated
orb2878454 100 µL

EHD3 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
PAK1 Antibody
orb1177560 100 µg

PAK1 Antibody

Sign In for Pricing
View Details
ZNF571 (h) -PR
sc-97619-PR 10 µM - 20 µL

ZNF571 (h) -PR

Sign In for Pricing
View Details
Recombinant Human ENO3, N-His
MBS1573388-01 0.1 mg

Recombinant Human ENO3, N-His

Sign In for Pricing
View Details