Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction beta-1 protein (Gjb1)

This Recombinant Mouse Gap junction beta-1 protein (Gjb1) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Gap junction beta-1 protein, Connexin-32, Cx32

UniProt

P28230

Expression Region

1-283

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0324507 1.0 µg DNA

C18orf25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PriboFast® Coconut ELISA Kit
EKT-CN10 96 Tests

PriboFast® Coconut ELISA Kit

Sign In for Pricing
View Details
Mphosph9 (NM_001081323) Mouse Tagged ORF Clone
MR222672 10 µg

Mphosph9 (NM_001081323) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Goat Anti-Alpaca IgG, VHH domain Polyclonal Antibody, HRP
PWB96431 100 µL

Goat Anti-Alpaca IgG, VHH domain Polyclonal Antibody, HRP

Sign In for Pricing
View Details
ALDH2 Conjugated Antibody
orb1617072 100 µL

ALDH2 Conjugated Antibody

Sign In for Pricing
View Details
LRRC32/GARP Mouse Monoclonal Antibody (APC)
orb2972645-01 50 Tests

LRRC32/GARP Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details