Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction beta-1 protein (Gjb1)

This Recombinant Mouse Gap junction beta-1 protein (Gjb1) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Gap junction beta-1 protein, Connexin-32, Cx32

UniProt

P28230

Expression Region

1-283

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(4-Fluoro-6-methyl-1,3-phenylene) bis (methylsulfane)
PC1018545-01 250 mg

(4-Fluoro-6-methyl-1,3-phenylene) bis (methylsulfane)

Sign In for Pricing
View Details
(4-Fluoro-6-methyl-1,3-phenylene) bis (methylsulfane)
PC1018545-02 500 mg

(4-Fluoro-6-methyl-1,3-phenylene) bis (methylsulfane)

Sign In for Pricing
View Details
(4-Fluoro-6-methyl-1,3-phenylene) bis (methylsulfane)
PC1018545-03 1 g

(4-Fluoro-6-methyl-1,3-phenylene) bis (methylsulfane)

Sign In for Pricing
View Details
Roxadustat (FG-4592)
C07428-50mg 50 mg

Roxadustat (FG-4592)

Sign In for Pricing
View Details
Human Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit
DLR-CTXII-Hu-48T 48 Tests

Human Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit

Sign In for Pricing
View Details
FAM75A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20112111 3x 1.0 µg

FAM75A1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details