Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ydaK (ydaK)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ydaK (ydaK) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydaK

UniProt

P96585

Expression Region

1-283

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKISFSESQKLFAYFSGLIAALSLFIYYVSAQQSEGALILCITFGVIAAGIWFGPIYALA VTLIVLFVLGTLMMFFQTGQTSLFPAEEGLRMLVVWGIALLLFSFISGRIHDITAELRRS MTRLQSEIKSYVAVDRVTGFDNKQRMKLELSEEIKRAERYGNSFVFLLLHMHYFKEFKSL YGEKETDRLFQYVGQQIRTSVRETDKKFRPSDERIGIVLTHTPAEHMPAVLTKLKKQLDT YQLENGKYVSLTFHVCYLPYRNDIQTADQFLEELENEMMMNEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCSH Antibody - middle region
OASG03053-100UL 100 µL

PRKCSH Antibody - middle region

Sign In for Pricing
View Details
AGAP5 (NM_001144000) Human Tagged ORF Clone
RG227075 10 µg

AGAP5 (NM_001144000) Human Tagged ORF Clone

Sign In for Pricing
View Details
[KO] NONO Mouse mAb
E2240093 100 µL

[KO] NONO Mouse mAb

Sign In for Pricing
View Details
SOX11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2261008 1.0 µg DNA

SOX11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
WDR41 (WD Repeat-containing Protein 41, MSTP048) (Biotin)
MBS6145170-01 0.1 mL

WDR41 (WD Repeat-containing Protein 41, MSTP048) (Biotin)

Sign In for Pricing
View Details
WDR41 (WD Repeat-containing Protein 41, MSTP048) (Biotin)
MBS6145170-02 5x 0.1 mL

WDR41 (WD Repeat-containing Protein 41, MSTP048) (Biotin)

Sign In for Pricing
View Details