Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ydaK (ydaK)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ydaK (ydaK) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydaK

UniProt

P96585

Expression Region

1-283

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKISFSESQKLFAYFSGLIAALSLFIYYVSAQQSEGALILCITFGVIAAGIWFGPIYALA VTLIVLFVLGTLMMFFQTGQTSLFPAEEGLRMLVVWGIALLLFSFISGRIHDITAELRRS MTRLQSEIKSYVAVDRVTGFDNKQRMKLELSEEIKRAERYGNSFVFLLLHMHYFKEFKSL YGEKETDRLFQYVGQQIRTSVRETDKKFRPSDERIGIVLTHTPAEHMPAVLTKLKKQLDT YQLENGKYVSLTFHVCYLPYRNDIQTADQFLEELENEMMMNEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD173212
C01643-25mg 25 mg

PD173212

Sign In for Pricing
View Details
ADAM8 HDR Plasmid (m2)
sc-418993-HDR-2 20 µg

ADAM8 HDR Plasmid (m2)

Sign In for Pricing
View Details
LAMC2 Recombinant Protein
OPCD04825-200UG 200 µg

LAMC2 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua 3-isopropylmalate dehydratase small subunit (leuD)
MBS1342318-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua 3-isopropylmalate dehydratase small subunit (leuD)
MBS1342318-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua 3-isopropylmalate dehydratase small subunit (leuD)
MBS1342318-03 0.02 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details