Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AmpE (ampE)

This Recombinant Protein AmpE (ampE) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Protein AmpE

UniProt

P0AE15

Expression Region

1-284

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLGMTIIAMGVTFLLLRA LQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSHARATMAGELTMIHGVP AGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLMGYAFLRAWQYWLARYQT PHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWFASLGDFHTSQYQVLTRLA QFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYGALV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (MaxLight 650)
MBS6267841-01 0.1 mL

c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (MaxLight 650)
MBS6267841-02 5x 0.1 mL

c-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
PRDM12 Peptide - C-terminal region
orb2002667 100 µg

PRDM12 Peptide - C-terminal region

Sign In for Pricing
View Details
Carboxypeptidase A1, Recombinant, Rat, aa111-419, His-tag, Myc-tag (Cpa1)
405888-01 20 µg

Carboxypeptidase A1, Recombinant, Rat, aa111-419, His-tag, Myc-tag (Cpa1)

Sign In for Pricing
View Details
Carboxypeptidase A1, Recombinant, Rat, aa111-419, His-tag, Myc-tag (Cpa1)
405888-02 100 µg

Carboxypeptidase A1, Recombinant, Rat, aa111-419, His-tag, Myc-tag (Cpa1)

Sign In for Pricing
View Details
Carboxypeptidase A1, Recombinant, Rat, aa111-419, His-tag, Myc-tag (Cpa1)
405888-03 1 mg

Carboxypeptidase A1, Recombinant, Rat, aa111-419, His-tag, Myc-tag (Cpa1)

Sign In for Pricing
View Details