Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-307.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8P2D8

Expression Region

24-307

Origin

Streptococcus pyogenes serotype M18

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQS WKASYQSEKMTFLKPVFEPINKRIKQASSQEEKMAAQTELMAAQRAHGINPLGGIGCLPL LIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQ REQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEY AKTPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HACE1 Mouse Monoclonal Antibody [Clone 10D3]
E45M19428V-2 50 µL

HACE1 Mouse Monoclonal Antibody [Clone 10D3]

Sign In for Pricing
View Details
Lentiviral human RHPN1 shRNA (UAS) - Lentiviral human RHPN1 shRNA (UAS, RFP) plasmid
GTR15139357 1 Vial

Lentiviral human RHPN1 shRNA (UAS) - Lentiviral human RHPN1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
MAPK6 Polyclonal Antibody, Biotin Conjugated
bs-12405R-Biotin 100 µL

MAPK6 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
FAM5B Protein Vector (Rat) (pPM-C-His)
PV267609 500 ng

FAM5B Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
RituBridge ELISA (for Rituxin Biosimilar comparison)
AB000204-01 1 PK

RituBridge ELISA (for Rituxin Biosimilar comparison)

Sign In for Pricing
View Details
RituBridge ELISA (for Rituxin Biosimilar comparison)
AB000204-02 5 PK

RituBridge ELISA (for Rituxin Biosimilar comparison)

Sign In for Pricing
View Details