Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Outward-rectifying potassium channel 4 (KCO4)

This Recombinant Arabidopsis thaliana Outward-rectifying potassium channel 4 (KCO4) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Outward-rectifying potassium channel 4, AtKCO4, Two-pore potassium channel 4, AtTPK4

UniProt

Q9FWX6

Expression Region

1-284

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEENLLNENLLHPNESSPEETQVTTVSKSKWTILVLAMILLLVYLTFGVCTYSFFRDQF SGTETNLFVDAFYFSIVTFSTVGYGDIVPSTSTTKILTIVLVSTGVVFLDYLLNRVVSHV LSLQENAILDRINKTRNRAIRDHIAEDGKIRLKWKLCLAFCAVGLCVGSGALFLHVFERL DWLDSVYLSVISVTTVGYGDKTFKTVEGRGFAVFWLLLSTIAMATLFLYLAEMRIDRTTV MKLPPSESEFIVFKLRESGRISEDDIKQIVREFENLEEVPSSGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-500 1x 500 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-500 1x 500 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-43 + DC10), CF640R conjugate, 0.1mg/mL
BNC400770-100 1x 100 µL

Cytokeratin 8/18 (C-43 + DC10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF488A conjugate, 0.1mg/mL
BNC881706-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details