Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1AXU8

Expression Region

1-284

Origin

Ruthia magnifica subsp. Calyptogena magnifica

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSATNEVITSGSYIKHHLQNLTYGQFPDGHWRFAHTTSEAKEMGFWAFHLDTLSISFILG ALFLIFFYKVGKKMTSDTPSGAQNFIESVIDFINDNVRGSFNSQNPMVAPLALTTFIWIV LMNTMDLVPVDWLPYVAQQIGVWLGADPHHVFFKMVPTADPNATLGMSIGIFILIIYYSI KEKGAGGFAAELTFHPFGKMMLPFNLFLEGVNLIAKPVSLALRLFGNMYAGEMIFILIAL LPFWVQWSLSLPWAIFHILIVLLQAFIFMTLVIVYMDMAHQKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI4E5]
CF806086 100 µg

FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI4E5]

Sign In for Pricing
View Details
Commd7 Mouse Gene Knockout Kit (CRISPR)
KN503669 1 Kit

Commd7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TAGLN3 (NM_001008273) Human Over-expression Lysate
LC423412 20 µg

TAGLN3 (NM_001008273) Human Over-expression Lysate

Sign In for Pricing
View Details
REA (PHB2) (NM_007273) Human Over-expression Lysate
LY402126 100 µg

REA (PHB2) (NM_007273) Human Over-expression Lysate

Sign In for Pricing
View Details
Picosulfate Sodium
TRC-P437550-10MG 10 mg

Picosulfate Sodium

Sign In for Pricing
View Details
KIR2DL2 Human Gene Knockout Kit (CRISPR)
KN424797 1 Kit

KIR2DL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details