Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1AXU8

Expression Region

1-284

Origin

Ruthia magnifica subsp. Calyptogena magnifica

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSATNEVITSGSYIKHHLQNLTYGQFPDGHWRFAHTTSEAKEMGFWAFHLDTLSISFILG ALFLIFFYKVGKKMTSDTPSGAQNFIESVIDFINDNVRGSFNSQNPMVAPLALTTFIWIV LMNTMDLVPVDWLPYVAQQIGVWLGADPHHVFFKMVPTADPNATLGMSIGIFILIIYYSI KEKGAGGFAAELTFHPFGKMMLPFNLFLEGVNLIAKPVSLALRLFGNMYAGEMIFILIAL LPFWVQWSLSLPWAIFHILIVLLQAFIFMTLVIVYMDMAHQKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD244 (NM_001166663) Human Over-expression Lysate
LC432954 20 µg

CD244 (NM_001166663) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DNAJC25 activation kit by CRISPRa
GA118619 1 Kit

Human DNAJC25 activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF385B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F9]
TA802761AM 100 µL

ZNF385B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F9]

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/1094), CF594 conjugate, 0.1mg/mL
BNC941858-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/1094), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS804164 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
N-Propionylglycine-2,2-d2
TRC-P788501-5MG 5 mg

N-Propionylglycine-2,2-d2

Sign In for Pricing
View Details