Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1AXU8

Expression Region

1-284

Origin

Ruthia magnifica subsp. Calyptogena magnifica

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSATNEVITSGSYIKHHLQNLTYGQFPDGHWRFAHTTSEAKEMGFWAFHLDTLSISFILG ALFLIFFYKVGKKMTSDTPSGAQNFIESVIDFINDNVRGSFNSQNPMVAPLALTTFIWIV LMNTMDLVPVDWLPYVAQQIGVWLGADPHHVFFKMVPTADPNATLGMSIGIFILIIYYSI KEKGAGGFAAELTFHPFGKMMLPFNLFLEGVNLIAKPVSLALRLFGNMYAGEMIFILIAL LPFWVQWSLSLPWAIFHILIVLLQAFIFMTLVIVYMDMAHQKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI2 Mouse Monoclonal Antibody [Clone ID: OTI1F2]
CF805210 100 µg

TFPI2 Mouse Monoclonal Antibody [Clone ID: OTI1F2]

Sign In for Pricing
View Details
RPA 202248-d3
TRC-R700917-1MG 1 mg

RPA 202248-d3

Sign In for Pricing
View Details
PORCN (NM_203474) Human Over-expression Lysate
LC404285 20 µg

PORCN (NM_203474) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF568 conjugate, 0.1mg/mL
BNC681389-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tfb2m Mouse Gene Knockout Kit (CRISPR)
KN517461 1 Kit

Tfb2m Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Osteoprotegerin (TNFRSF11B) Mouse Monoclonal Antibody [Clone ID: 5A11]
AM06550SU-N 100 µL

Osteoprotegerin (TNFRSF11B) Mouse Monoclonal Antibody [Clone ID: 5A11]

Sign In for Pricing
View Details