Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 2 (yidC2)

This Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-307.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

P0DC89

Expression Region

24-307

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQS WKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPL LIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQ REQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEY AKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117 (C117/370), 0.2mg/mL
BNUB0370-100 1x 100 µL

CD117 (C117/370), 0.2mg/mL

Sign In for Pricing
View Details
Bcl2l14 Mouse Gene Knockout Kit (CRISPR)
KN502106 1 Kit

Bcl2l14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Acyclovir Formacetal Dimer (>90%)
TRC-A192435-25MG 25 mg

Acyclovir Formacetal Dimer (>90%)

Sign In for Pricing
View Details
Hexyl Octyl Phthalate
TRC-B185420-50MG 50 mg

Hexyl Octyl Phthalate

Sign In for Pricing
View Details
2,5-Hexanedione-d10
TRC-H292492-500MG 500 mg

2,5-Hexanedione-d10

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS701622 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details