Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 2 (yidC2)

This Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-307.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

P0DC89

Expression Region

24-307

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQS WKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPL LIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQ REQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEY AKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Buccutite™ Peroxidase (HRP) Antibody Conjugation Kit *Optimized for Labeling 100 ug Protein*
5503-AAT 2 Labelings

Buccutite™ Peroxidase (HRP) Antibody Conjugation Kit *Optimized for Labeling 100 ug Protein*

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: right
CB527409 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS501082 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
CD44 (NM_000610) Human Recombinant Protein
TP720465XL 1 mg

CD44 (NM_000610) Human Recombinant Protein

Sign In for Pricing
View Details
Human RBP4 Recombinant Rabbit monoclonal Antibody
HA723689 100 µL

Human RBP4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2463), Biotin conjugate, 0.1mg/mL
BNCB2463-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2463), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details