Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 2 (yidC2)

This Recombinant Streptococcus pyogenes serotype M3 Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-307.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

P0DC89

Expression Region

24-307

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQS WKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPL LIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQ REQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEY AKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2M3 Antibody
8G561-AAT 50 µg

OR2M3 Antibody

Sign In for Pricing
View Details
(3alpha)-3-Acetate-17-(3-pyridinyl)-androsta-5,16-dien-3-ol
TRC-A248180-10MG 10 mg

(3alpha)-3-Acetate-17-(3-pyridinyl)-androsta-5,16-dien-3-ol

Sign In for Pricing
View Details
XL413
TRC-X746230-25MG 25 mg

XL413

Sign In for Pricing
View Details
FITC Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017C-01 50 Tests

FITC Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017C-02 100 Tests

FITC Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017C-03 2x 100 Tests

FITC Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details