Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-307.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

P0DC88

Expression Region

24-307

Origin

Streptococcus pyogenes serotype M3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQS WKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPL LIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQ REQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEY AKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemin7 (NM_027189) Mouse Tagged ORF Clone
MG200714 10 µg

Gemin7 (NM_027189) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Interleukin 8 Receptor Beta (IL8Rb) ELISA Kit
RDR-IL8Rb-Mu-01 96 Tests

Mouse Interleukin 8 Receptor Beta (IL8Rb) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 8 Receptor Beta (IL8Rb) ELISA Kit
RDR-IL8Rb-Mu-02 48 Tests

Mouse Interleukin 8 Receptor Beta (IL8Rb) ELISA Kit

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
OC-026-01 50 μL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
OC-026-02 100 µL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
OC-026-03 1 mL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details