Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-307.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

P0DC88

Expression Region

24-307

Origin

Streptococcus pyogenes serotype M3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQS WKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPL LIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQ REQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEY AKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nostrin Mouse Gene Knockout Kit (CRISPR)
KN311123RB 1 Kit

Nostrin Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GAS2L2 Human qPCR Primer Pair (NM_139285)
HP217162 200 Reactions

GAS2L2 Human qPCR Primer Pair (NM_139285)

Sign In for Pricing
View Details
CD4, Mouse (T-Cell Marker) (GK1.5), CF680 conjugate, 0.1mg/mL
BNC802009-100 1x 100 µL

CD4, Mouse (T-Cell Marker) (GK1.5), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (Cocktail), Biotin conjugate, 0.1mg/mL
BNCB1018-100 1x 100 µL

CD117 (Cocktail), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDK2 Rabbit Polyclonal Antibody
AP02642PU-S 50 µL

CDK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G8]
TA502542BM 100 µL

GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G8]

Sign In for Pricing
View Details