Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Translocase of inner mitochondrial membrane domain-containing protein 1 (Timmdc1)

This Recombinant Mouse Translocase of inner mitochondrial membrane domain-containing protein 1 (Timmdc1) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Translocase of inner mitochondrial membrane domain-containing protein 1

UniProt

Q8BUY5

Expression Region

1-285

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAPPPAPRSRLCGAWGPFPRVFAAGAVAADSPGFVEDREQRSGVSDPGSLESGWDRLRQ LFAKDEQQRFSKEIDYIYRAAVSAGIIGWAYGGIPAFIYAKKRYIEQSQAEIYHNRFDAV QSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDAMSHFAIAGAVTGGLFR INLGVRGLVAGSIIGALLGAPMGSLLMALEKYSGETVQERRQKEWKALHEQRLEEWRSSL QVTELLPMEIESGLEKIQPEGDAQRIEELLSLPRNPSSPHQQSKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-500 1x 500 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details