Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Leukocyte surface antigen CD47 (CD47)

This Recombinant Bovine Leukocyte surface antigen CD47 (CD47) spans the amino acid sequence from region 19-303.

Product Specifications

Product Name Alternative

Leukocyte surface antigen CD47, Integrin-associated protein, IAP, CD_antigen= CD47

UniProt

Q9N0K1

Expression Region

19-303

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QLIFNAIKSVEYTLCNQTVVIPCFVNNVETKNITELYVRWKFKGENIFIFDGSQRMSKPS SNFSSAEIAPSELLRGIASLKMAKSDAVLGNYTCEVTELSREGETIIELKYRVVSWFSPN ENILIVIFPVLAILLFWGQFGIVTLKYKSNYTKEKAIFLLVAGLLLTVLVIVGAFLFIPG GYSTKNASGLGLIVLPTIILILLHYCVFMIAMGMSSFTISILILQLLGYVLSVVGFSLCV SECIPVHGPLLISGLGIIALAELLGLVYMKCVASNHRTIQPPRNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), Biotin conjugate, 0.1mg/mL
BNCB0204-100 1x 100 µL

Complement C4d (C4D204), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VAC14 (NM_018052) Human Recombinant Protein
TP314195M 100 µg

VAC14 (NM_018052) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant GAD1 Antibody
RC-3072-01 50 μL

Recombinant GAD1 Antibody

Sign In for Pricing
View Details
Recombinant GAD1 Antibody
RC-3072-02 100 µL

Recombinant GAD1 Antibody

Sign In for Pricing
View Details
Recombinant GAD1 Antibody
RC-3072-03 1 mL

Recombinant GAD1 Antibody

Sign In for Pricing
View Details
Thiosemicarbazide
TRC-H686500-1G 1 g

Thiosemicarbazide

Sign In for Pricing
View Details