Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chemotaxis protein LafT (lafT)

This Recombinant Chemotaxis protein LafT (lafT) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Chemotaxis protein LafT

UniProt

Q03477

Expression Region

1-285

Origin

Vibrio parahaemolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKFLGVLTILVCVFGGYMWAGGKLGAIWQPAEFLIIIGAAAGSLIIGNPPHVLKEMRQQ VPATIKGPTEEYEYYMELMALLNNLLETARSRGFKFLDSHIEAPEQSSIFLMYPLVSEDH RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQNELLLPSRSLQRTAEALPGFGILAA VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCGLDPLSNAMAQRVKRNMTAFEC VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS706997 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS624967 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
ARSB (Center) Rabbit Polyclonal Antibody
AP17890PU-N 400 µL

ARSB (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Navigator® Lysosome Staining Kit *Orange Fluorescence*
22657-AAT 500 Tests

Cell Navigator® Lysosome Staining Kit *Orange Fluorescence*

Sign In for Pricing
View Details
Pseudomonic Acid D Sodium (>90%)
TRC-P839520-1MG 1 mg

Pseudomonic Acid D Sodium (>90%)

Sign In for Pricing
View Details
Protonex™ Green 500-PEG12, SE
21219-AAT 1 mg

Protonex™ Green 500-PEG12, SE

Sign In for Pricing
View Details