Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chemotaxis protein LafT (lafT)

This Recombinant Chemotaxis protein LafT (lafT) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Chemotaxis protein LafT

UniProt

Q03477

Expression Region

1-285

Origin

Vibrio parahaemolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKFLGVLTILVCVFGGYMWAGGKLGAIWQPAEFLIIIGAAAGSLIIGNPPHVLKEMRQQ VPATIKGPTEEYEYYMELMALLNNLLETARSRGFKFLDSHIEAPEQSSIFLMYPLVSEDH RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQNELLLPSRSLQRTAEALPGFGILAA VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCGLDPLSNAMAQRVKRNMTAFEC VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COA8 (NM_032374) Human Over-expression Lysate
LC432145 20 µg

COA8 (NM_032374) Human Over-expression Lysate

Sign In for Pricing
View Details
PARP1 (N-term) Rabbit Polyclonal Antibody
AP22756PU-N 250 µL

PARP1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]
AN00567H-01 50 Tests

PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]
AN00567H-02 100 Tests

PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]
AN00567H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Squaric Acid Ester Amido PEG
1310000-00-50.1G 1 g

Ɑ-Hydroxy-ω-Squaric Acid Ester Amido PEG

Sign In for Pricing
View Details