Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chemotaxis protein LafT (lafT)

This Recombinant Chemotaxis protein LafT (lafT) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Chemotaxis protein LafT

UniProt

Q03477

Expression Region

1-285

Origin

Vibrio parahaemolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKFLGVLTILVCVFGGYMWAGGKLGAIWQPAEFLIIIGAAAGSLIIGNPPHVLKEMRQQ VPATIKGPTEEYEYYMELMALLNNLLETARSRGFKFLDSHIEAPEQSSIFLMYPLVSEDH RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQNELLLPSRSLQRTAEALPGFGILAA VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCGLDPLSNAMAQRVKRNMTAFEC VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
FGFR3 Rabbit Polyclonal Antibody
TA376240 100 µL

FGFR3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRH Receptor (TRHR) Rabbit Polyclonal Antibody
AP01441PU-N 100 µg

TRH Receptor (TRHR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tpsab1 Mouse Gene Knockout Kit (CRISPR)
KN518108 1 Kit

Tpsab1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker), CF647 conjugate, 0.1mg/mL
BNC471675-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details