Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis Protease HtpX homolog (htpX)

This Recombinant Mycobacterium bovis Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A1KG40

Expression Region

1-286

Origin

Mycobacterium bovis (strain BCG / Pasteur 1173P2)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGMNVYVYFNSDKLALRA MHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFATGRNPRNAAVCCTTGI LRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALANMAMWAGMFGGNRDNANP FALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLP PEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLEAMARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC3 (Mucin 3) (MUC3/2992R), CF405S conjugate, 0.1mg/mL
BNC042992-100 1x 100 µL

MUC3 (Mucin 3) (MUC3/2992R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), CF647 conjugate, 0.1mg/mL
BNC472476-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1398), CF594 conjugate, 0.1mg/mL
BNC941398-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/1398), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL
BNC402074-100 1x 100 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details