Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1 (yidC1)

This Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 23-308.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q8DNE1

Expression Region

23-308

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQ SWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFP ILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDE MQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVHE ELAKNPSKASAFSTPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Resistin Recombinant Rabbit monoclonal Antibody
HA723658 100 µL

Human Resistin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human RBMY1E activation kit by CRISPRa
GA117853 1 Kit

Human RBMY1E activation kit by CRISPRa

Sign In for Pricing
View Details
UNC119B (NM_001080533) Human Over-expression Lysate
LY421088 100 µg

UNC119B (NM_001080533) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Leukocyte Associated Immunoglobulin Like Receptor 1 (LAIR1) ELISA Kit
RDR-LAIR1-Hu-01 96 Tests

Human Leukocyte Associated Immunoglobulin Like Receptor 1 (LAIR1) ELISA Kit

Sign In for Pricing
View Details
Human Leukocyte Associated Immunoglobulin Like Receptor 1 (LAIR1) ELISA Kit
RDR-LAIR1-Hu-02 48 Tests

Human Leukocyte Associated Immunoglobulin Like Receptor 1 (LAIR1) ELISA Kit

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details