Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1 (yidC1)

This Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 23-308.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q8DNE1

Expression Region

23-308

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQ SWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFP ILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDE MQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVHE ELAKNPSKASAFSTPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100504041 3'UTR Luciferase Stable Cell Line
TU111950 1.0 mL

LOC100504041 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FBXL6 (NM_012162) Human Tagged Lenti ORF Clone
RC207676L3 10 µg

FBXL6 (NM_012162) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Goat Polyclonal CSN1 Antibody
NB100-1237 0.1 mg

Goat Polyclonal CSN1 Antibody

Sign In for Pricing
View Details
LAMP1 Mouse mAb, Cy5 conjugated
orb2361938 100 µL

LAMP1 Mouse mAb, Cy5 conjugated

Sign In for Pricing
View Details
Lentiviral human ITGB6 shRNA (UAS) - Lentiviral human ITGB6 shRNA (UAS, iRFP) (25)
GTR15295685 1 Vial

Lentiviral human ITGB6 shRNA (UAS) - Lentiviral human ITGB6 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
TAB3 discontinued
542839-01 30ul

TAB3 discontinued

Sign In for Pricing
View Details