Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1 (yidC1)

This Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 23-308.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q8DNE1

Expression Region

23-308

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQ SWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFP ILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDE MQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVHE ELAKNPSKASAFSTPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRRM4 Protein Vector (Human) (pPM-C-His)
PV133493 500 ng

SRRM4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
MAGE-C1 (AB1814) Rabbit mAb (Ready to Use)
M3791R-01 3 mL

MAGE-C1 (AB1814) Rabbit mAb (Ready to Use)

Sign In for Pricing
View Details
MAGE-C1 (AB1814) Rabbit mAb (Ready to Use)
M3791R-02 6 mL

MAGE-C1 (AB1814) Rabbit mAb (Ready to Use)

Sign In for Pricing
View Details
MAGE-C1 (AB1814) Rabbit mAb (Ready to Use)
M3791R-03 10 mL

MAGE-C1 (AB1814) Rabbit mAb (Ready to Use)

Sign In for Pricing
View Details
CCL8 Knockout HAP1 Polyclonal Cells
ARG43205 1 Million

CCL8 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Aged Rat Bone Marrow Mesenchymal Stem Cells
ABC-H0101X 1 Vial

Aged Rat Bone Marrow Mesenchymal Stem Cells

Sign In for Pricing
View Details