Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CLN8 (CLN8)

This Recombinant Human Protein CLN8 (CLN8) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Protein CLN8

UniProt

Q9UBY8

Expression Region

1-286

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLNATYRSLVARE KVFWDLAATRAVFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVA VHLSNLIFRTFDLFLVIHHLFAFLGFLGCLVNLQAGHYLAMTTLLLEMSTPFTCVSWMLL KAGWSESLFWKLNQWLMIHMFHCRMVLTYHMWWVCFWHWDGLVSSLYLPHLTLFLVGLAL LTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEGNGQLLRKKRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl G Long discontinued
B0807-20-01 50 µg

Bcl G Long discontinued

Sign In for Pricing
View Details
Bcl G Long discontinued
B0807-20-02 100 µg

Bcl G Long discontinued

Sign In for Pricing
View Details
IRF5 Human Over-expression Lysate
orb1364477 20 µg

IRF5 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Tubulin alpha-1B Antibody (OTI3G3) [Alexa Fluor 532]
NBP2-74703AF532 0.1 mL

Mouse Monoclonal Tubulin alpha-1B Antibody (OTI3G3) [Alexa Fluor 532]

Sign In for Pricing
View Details
Goat anti-RASIP1/RAIN Antibody
MBS420231-01 0.1 mg

Goat anti-RASIP1/RAIN Antibody

Sign In for Pricing
View Details
Goat anti-RASIP1/RAIN Antibody
MBS420231-02 5x 0.1 mg

Goat anti-RASIP1/RAIN Antibody

Sign In for Pricing
View Details