Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-6 protein (Gja6)

This Recombinant Rat Gap junction alpha-6 protein (Gja6) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Gap junction alpha-6 protein, Connexin-33, Cx33

UniProt

P28233

Expression Region

1-286

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPG CENVCYDQAFPISHVRLWVLQVIFVSVPTLLHLAHVYYVIRQNEKLKKQEEEELKVAHFN GASGERRLQKHTGKHIKCGSKEHGNRKMRGRLLLTYMASIFFKSVFEVAFLLIQWYLYGF TLSAVYICEQSPCPHRVDCFLSRPTEKTIFILFMLVVSMVSFVLNVIELFYVLFKAIKNH LGNEKEEVYCNPVELQKPSCVSSSAVLTTICSSDQVVPVGLSSFYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium (Z)-1-Hydroxynon-3-ene-1-sulfonate
TRC-S699338-250MG 250 mg

Sodium (Z)-1-Hydroxynon-3-ene-1-sulfonate

Sign In for Pricing
View Details
IKK beta Antibody (phospho-S689)
F48703-0.08ML 0.08 mL

IKK beta Antibody (phospho-S689)

Sign In for Pricing
View Details
MT-RNR2 antibody
FNab04079 100 µg

MT-RNR2 antibody

Sign In for Pricing
View Details
Renin (REN) Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF807103 100 µg

Renin (REN) Mouse Monoclonal Antibody [Clone ID: OTI1D3]

Sign In for Pricing
View Details
Mouse IL-6, C-His Tag
HA210667-01 20 µg

Mouse IL-6, C-His Tag

Sign In for Pricing
View Details
Mouse IL-6, C-His Tag
HA210667-02 50 µg

Mouse IL-6, C-His Tag

Sign In for Pricing
View Details