Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-6 protein (Gja6)

This Recombinant Rat Gap junction alpha-6 protein (Gja6) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Gap junction alpha-6 protein, Connexin-33, Cx33

UniProt

P28233

Expression Region

1-286

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPG CENVCYDQAFPISHVRLWVLQVIFVSVPTLLHLAHVYYVIRQNEKLKKQEEEELKVAHFN GASGERRLQKHTGKHIKCGSKEHGNRKMRGRLLLTYMASIFFKSVFEVAFLLIQWYLYGF TLSAVYICEQSPCPHRVDCFLSRPTEKTIFILFMLVVSMVSFVLNVIELFYVLFKAIKNH LGNEKEEVYCNPVELQKPSCVSSSAVLTTICSSDQVVPVGLSSFYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dental Autoclave BADT-104
BADT-104 1 Unit

Dental Autoclave BADT-104

Sign In for Pricing
View Details
Polystyrene AM RAM, low loaded
HLL40023.25G 25 g

Polystyrene AM RAM, low loaded

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702961 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Over-expression Lysate
LC401298 20 µg

P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Etaa1 activation kit by CRISPRa
GA207694 1 Kit

Mouse Etaa1 activation kit by CRISPRa

Sign In for Pricing
View Details
Adamts15 Mouse Gene Knockout Kit (CRISPR)
KN500853 1 Kit

Adamts15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details