Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-6 protein (Gja6)

This Recombinant Rat Gap junction alpha-6 protein (Gja6) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Gap junction alpha-6 protein, Connexin-33, Cx33

UniProt

P28233

Expression Region

1-286

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPG CENVCYDQAFPISHVRLWVLQVIFVSVPTLLHLAHVYYVIRQNEKLKKQEEEELKVAHFN GASGERRLQKHTGKHIKCGSKEHGNRKMRGRLLLTYMASIFFKSVFEVAFLLIQWYLYGF TLSAVYICEQSPCPHRVDCFLSRPTEKTIFILFMLVVSMVSFVLNVIELFYVLFKAIKNH LGNEKEEVYCNPVELQKPSCVSSSAVLTTICSSDQVVPVGLSSFYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp580 Mouse Gene Knockout Kit (CRISPR)
KN519889 1 Kit

Zfp580 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C7orf59 (LAMTOR4) (NM_001008395) Human Recombinant Protein
TP309099M 100 µg

C7orf59 (LAMTOR4) (NM_001008395) Human Recombinant Protein

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF405S conjugate, 0.1mg/mL
BNC041485-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR Human Gene Knockout Kit (CRISPR)
KN214877 1 Kit

EGFR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Chloroindole-2-carboxylic Acid
TRC-C377710-25G 25 g

5-Chloroindole-2-carboxylic Acid

Sign In for Pricing
View Details
C8orf74 (NM_001040032) Human Over-expression Lysate
LC421882 20 µg

C8orf74 (NM_001040032) Human Over-expression Lysate

Sign In for Pricing
View Details