Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Protease HtpX (htpX)

This Recombinant Shewanella sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A0KY72

Expression Region

1-287

Origin

Shewanella sp. (strain ANA-3)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDSTERWLLDTVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEVEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKHKMIAAL ERLRQGPESSAMPAQMSAFGINGKRSMAELMMSHPPLEKRIAALQTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Noscapine Hydrochloride
TRC-N882018-5G 5 g

Noscapine Hydrochloride

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), CF405S conjugate, 0.1mg/mL
BNC043295-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rab6a Mouse Gene Knockout Kit (CRISPR)
KN514381 1 Kit

Rab6a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARHGAP17 (N-term) Rabbit Polyclonal Antibody
AP50234PU-N 400 µL

ARHGAP17 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UPRT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F2]
TA506872AM 100 µL

UPRT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F2]

Sign In for Pricing
View Details
MIR887 Human qPCR Primer Pair (MI0005562)
HP300599 200 Reactions

MIR887 Human qPCR Primer Pair (MI0005562)

Sign In for Pricing
View Details