Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Protease HtpX (htpX)

This Recombinant Shewanella sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A0KY72

Expression Region

1-287

Origin

Shewanella sp. (strain ANA-3)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDSTERWLLDTVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEVEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKHKMIAAL ERLRQGPESSAMPAQMSAFGINGKRSMAELMMSHPPLEKRIAALQTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amino-PEG2-alcohol
TRC-A609095-10G 10 g

Amino-PEG2-alcohol

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509088 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS500008 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS502085 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details