Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Protease HtpX (htpX)

This Recombinant Shewanella sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A0KY72

Expression Region

1-287

Origin

Shewanella sp. (strain ANA-3)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDSTERWLLDTVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEVEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKHKMIAAL ERLRQGPESSAMPAQMSAFGINGKRSMAELMMSHPPLEKRIAALQTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBED4 Human Gene Knockout Kit (CRISPR)
KN423963 1 Kit

ZBED4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD72 (NM_001782) Human Over-expression Lysate
LC400673 20 µg

CD72 (NM_001782) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM97 Human Gene Knockout Kit (CRISPR)
KN416927 1 Kit

TMEM97 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Serological Pipette BPIC-602
BPIC-602 1 Unit

Serological Pipette BPIC-602

Sign In for Pricing
View Details
NOTCH4 Human Gene Knockout Kit (CRISPR)
KN221762BN 1 Kit

NOTCH4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Tcea1 activation kit by CRISPRa
GA204229 1 Kit

Mouse Tcea1 activation kit by CRISPRa

Sign In for Pricing
View Details