Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Protease HtpX (htpX)

This Recombinant Shewanella sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A1RIL6

Expression Region

1-287

Origin

Shewanella sp. (strain W3-18-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK AMGCEVITMPRDGTERWLVETVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEVEAVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNVVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKHKMIAAL ERLRQGPESTAMPAQMSAFGINGKRSMAEMMMSHPPLEKRIAALQAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF568 conjugate, 0.1mg/mL
BNC682368-100 1x 100 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Disperse Yellow 9 (Technical Grade)
TRC-D995360-1G 1 g

Disperse Yellow 9 (Technical Grade)

Sign In for Pricing
View Details
Human ZDHHC6 activation kit by CRISPRa
GA112079 1 Kit

Human ZDHHC6 activation kit by CRISPRa

Sign In for Pricing
View Details
Ep-CAM / CD326 (Rat) (GZ-20), Biotin conjugate, 0.1mg/mL
BNCB0382-100 1x 100 µL

Ep-CAM / CD326 (Rat) (GZ-20), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desethyl Fenfluramine Hydrochloride
TRC-D289425-50MG 50 mg

Desethyl Fenfluramine Hydrochloride

Sign In for Pricing
View Details
Human ESX1 activation kit by CRISPRa
GA112951 1 Kit

Human ESX1 activation kit by CRISPRa

Sign In for Pricing
View Details