Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Protease HtpX (htpX)

This Recombinant Shewanella sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A1RIL6

Expression Region

1-287

Origin

Shewanella sp. (strain W3-18-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK AMGCEVITMPRDGTERWLVETVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEVEAVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNVVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKHKMIAAL ERLRQGPESTAMPAQMSAFGINGKRSMAEMMMSHPPLEKRIAALQAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alternamine B Hydrochloride
TRC-A206480-1MG 1 mg

Alternamine B Hydrochloride

Sign In for Pricing
View Details
2-Oxo-1-benzimidazolinebutyric Acid
TRC-O869600-250MG 250 mg

2-Oxo-1-benzimidazolinebutyric Acid

Sign In for Pricing
View Details
CCK4 (PTK7) (N-term) Rabbit Polyclonal Antibody
AP05710PU-N 100 µg

CCK4 (PTK7) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS635515 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-501
BCLT-501 1 Unit

Low Temperature Circulator BCLT-501

Sign In for Pricing
View Details
PBP (PEBP1) (Center) Rabbit Polyclonal Antibody
AP15048PU-N 400 µL

PBP (PEBP1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details