Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Protease HtpX (htpX)

This Recombinant Shewanella baltica Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A6WPJ1

Expression Region

1-287

Origin

Shewanella baltica (strain OS185)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDSTERWLVETVARQAKQAGIKMPEVAIYQSSDMNAFATGPSKDNSLVAV STGLLYGMSQDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYKADEGAARLAGKGKMIAAL ERLRQGPESTAMPAQMSAFGINGKRSMAEMMMSHPPLEKRIAALRAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189M-01 50 Tests

Elab Fluor® 647 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189M-02 100 Tests

Elab Fluor® 647 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Myosin (MYL4) Mouse Monoclonal Antibody [Clone ID: AT4E8]
AM50061PU-S 50 µL

Myosin (MYL4) Mouse Monoclonal Antibody [Clone ID: AT4E8]

Sign In for Pricing
View Details
4-Phenylbutylamine
TRC-P399615-50MG 50 mg

4-Phenylbutylamine

Sign In for Pricing
View Details
PE/AF594 Armenian Hamster IgG Isotype Control
RD30077F-01 25 µg

PE/AF594 Armenian Hamster IgG Isotype Control

Sign In for Pricing
View Details