Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Protease HtpX (htpX)

This Recombinant Shewanella baltica Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A9L578

Expression Region

1-287

Origin

Shewanella baltica (strain OS195)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDSTERWLVETVARQAKQAGIKMPEVAIYQSPDMNAFATGPSKDNSLVAV STGLLYGMSQDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYKADEGAARLAGKGKMIAAL ERLRQGPESTAMPAQMSAFGINGKRSMAEMMMSHPPLEKRIAALRAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (rS100A4/1481), CF405S conjugate, 0.1mg/mL
BNC043186-500 1x 500 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (rS100A4/1481), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fluchloraminopyr-tefuryl
TRC-F353970-50MG 50 mg

Fluchloraminopyr-tefuryl

Sign In for Pricing
View Details
ATG9B Human Gene Knockout Kit (CRISPR)
KN424817 1 Kit

ATG9B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOPA Decarboxylase Antibody
KC-26416-01 50 μL

DOPA Decarboxylase Antibody

Sign In for Pricing
View Details
DOPA Decarboxylase Antibody
KC-26416-02 100 µL

DOPA Decarboxylase Antibody

Sign In for Pricing
View Details
DOPA Decarboxylase Antibody
KC-26416-03 1 mL

DOPA Decarboxylase Antibody

Sign In for Pricing
View Details