Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Protease HtpX (htpX)

This Recombinant Vibrio cholerae serotype O1 Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

C3LU14

Expression Region

1-287

Origin

Vibrio cholerae serotype O1 (strain M66-2)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRILLFLATNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAAVFGFGGAFISLLMSKS MALRSVGGVVIDTPRNEMEHWLLETVRRQANQAGIGMPTVAIYDAPDMNAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANIVAS RDSEEGEGSNMMVYFGVSMVLELVFGFLASFITMWYSRHREFHADAGAAQLVGKHKMIAA LERLKMGQESHLEGSMMAFGITGKRSLSELMMTHPPLEKRIAALRNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-500 1x 500 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (2D2), CF568 conjugate, 0.1mg/mL
BNC680004-500 1x 500 µL

Bax (2D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 (GI Epithelial Marker) (CDX2/2951R), CF594 conjugate, 0.1mg/mL
BNC942951-500 1x 500 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF568 conjugate, 0.1mg/mL
BNC681789-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details