Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella denitrificans Protease HtpX (htpX)

This Recombinant Shewanella denitrificans Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q12MB4

Expression Region

1-287

Origin

Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRVFLLIATNLAILLVASIVMSILGVNTSTMGGLLVFAAIFGFGGSFISLAISKWMAKK TMGCEVIVQPRDETERWLVDTVTRQAKQAGINMPEVAIYQSPEMNAFATGPSKNNALVAV STGLLYGMTRDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIIDNFVSS NDEEGQGLGMFAYMGVVFVLDMLFGILASIIVAYFSRIREFKADEGAARLAGKDKMIAAL ERLRAGPESGAMPAQMSAFGINGKRSMADFMMSHPPLEKRIAALKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TF2H2 Antibody
8C11010-AAT 50 µg

TF2H2 Antibody

Sign In for Pricing
View Details
Ethyl 3-Oxohept-6-enoate
TRC-E929308-250MG 250 mg

Ethyl 3-Oxohept-6-enoate

Sign In for Pricing
View Details
Human Reactive Exosome Marker Antibody Sampler Kit
HAK21094 1 Kit

Human Reactive Exosome Marker Antibody Sampler Kit

Sign In for Pricing
View Details
Ferritin Conjugated Griffonia simplicifolia Lectin -GS-II-
I-2402-1 1 mg

Ferritin Conjugated Griffonia simplicifolia Lectin -GS-II-

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Purified Anti-Human CD2 Antibody[HIT11]
E-AB-F1311A-01 25 µg

Purified Anti-Human CD2 Antibody[HIT11]

Sign In for Pricing
View Details