Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella denitrificans Protease HtpX (htpX)

This Recombinant Shewanella denitrificans Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q12MB4

Expression Region

1-287

Origin

Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRVFLLIATNLAILLVASIVMSILGVNTSTMGGLLVFAAIFGFGGSFISLAISKWMAKK TMGCEVIVQPRDETERWLVDTVTRQAKQAGINMPEVAIYQSPEMNAFATGPSKNNALVAV STGLLYGMTRDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIIDNFVSS NDEEGQGLGMFAYMGVVFVLDMLFGILASIIVAYFSRIREFKADEGAARLAGKDKMIAAL ERLRAGPESGAMPAQMSAFGINGKRSMADFMMSHPPLEKRIAALKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N,N'-(N,N'-Dicarboxy-L-cystyl)di-glycine Dibenzyl N,N'-Di-tert-butyl Ester
TRC-D430985-25MG 25 mg

N,N'-(N,N'-Dicarboxy-L-cystyl)di-glycine Dibenzyl N,N'-Di-tert-butyl Ester

Sign In for Pricing
View Details
Human B7 H6 (NCR3LG1) activation kit by CRISPRa
GA117762 1 Kit

Human B7 H6 (NCR3LG1) activation kit by CRISPRa

Sign In for Pricing
View Details
HCK (NM_001172130) Human Over-expression Lysate
LY433231 100 µg

HCK (NM_001172130) Human Over-expression Lysate

Sign In for Pricing
View Details
Ipragliflozin
TRC-I739475-10MG 10 mg

Ipragliflozin

Sign In for Pricing
View Details
Biotin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW15F4-BIO 10x 96 Well Plates

Biotin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
Tissue Protein Lysate, Skin
CP565877 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details