Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chromohalobacter salexigens ATP synthase subunit a (atpB)

This Recombinant Chromohalobacter salexigens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q1QSC4

Expression Region

1-287

Origin

Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGNNPTSSEYIQHHLQNMTFGLHPENGLGLAHSAQEAQEMGFWAIHLDTMGWSIGLGVL FLWLFRSVAKSVSTGVPGGLQNFVEMMVEFVDNSVRETFHGKSKLIAPLSLTIFCWIFLM NLMDLVPVDFLPMLAQKIGAWFGADPAHVYFKVVPTTDVNATLGMSLAVFALIIFYSIRS KGLSGFLAELTLHPFNASNPFVQALLIPVNFLLEAVTLLAKPVSLALRLFGNLYAGELIF ILIAMIGLWQLPLHFAWATFHILIITLQAFIFMMLTIVYLSMATEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-500 1x 500 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF740 conjugate, 0.1mg/mL
BNC741909-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details