Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q87QN1

Expression Region

1-287

Origin

Vibrio parahaemolyticus

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIMLFLATNLAVVLVLSVVLNIVYATTGMQPGSLSGLLVMAAVFGFGGALISLMMSKG MALRSVGGMVIESPRNETEHWLLETVGRQAQQAGIGMPTVAIYDSADINAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANIVAS NDDEEGQGTNMMVYFGVSMVLELVFGFLASFITMWYSRHREFHADAGAARLVGKEKMIAA LERLKMSQESKLDGTMMAFGINGKQSLTELLMSHPPLDKRIAALRNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details