Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q87QN1

Expression Region

1-287

Origin

Vibrio parahaemolyticus

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIMLFLATNLAVVLVLSVVLNIVYATTGMQPGSLSGLLVMAAVFGFGGALISLMMSKG MALRSVGGMVIESPRNETEHWLLETVGRQAQQAGIGMPTVAIYDSADINAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANIVAS NDDEEGQGTNMMVYFGVSMVLELVFGFLASFITMWYSRHREFHADAGAARLVGKEKMIAA LERLKMSQESKLDGTMMAFGINGKQSLTELLMSHPPLDKRIAALRNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG16L1 Blocking Peptide
MBS9623998-01 1 mg

ATG16L1 Blocking Peptide

Sign In for Pricing
View Details
ATG16L1 Blocking Peptide
MBS9623998-02 5x 1 mg

ATG16L1 Blocking Peptide

Sign In for Pricing
View Details
Anti-Tropomodulin 2 Antibody (2P149)
TMAB-13833-01 25 µL

Anti-Tropomodulin 2 Antibody (2P149)

Sign In for Pricing
View Details
Anti-Tropomodulin 2 Antibody (2P149)
TMAB-13833-02 50 μL

Anti-Tropomodulin 2 Antibody (2P149)

Sign In for Pricing
View Details
Anti-Tropomodulin 2 Antibody (2P149)
TMAB-13833-03 100 µL

Anti-Tropomodulin 2 Antibody (2P149)

Sign In for Pricing
View Details
LAMB1 (Laminin, beta 1, CLM, MGC142015)
248064 50 µg

LAMB1 (Laminin, beta 1, CLM, MGC142015)

Sign In for Pricing
View Details