Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8DY84

Expression Region

24-310

Origin

Streptococcus agalactiae serotype V

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVSVDKAGKPYGVIWNTLGVPMANLITYFAQHQGLGFGVAIIIVTVIVRVVILPLGLYQS WKASYQAEKMAYFKPLFEPINERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPL LIQMPFFSAIFFAARYTPGVSSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQ RQQMKTMMYLMPIMMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEY TKNPPKAYKANNARKDVTNSTKATESNQAIITSKKTNRNAGKQKRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP3 polyclonal antibody
BS71909-01 50 µL

BMP3 polyclonal antibody

Sign In for Pricing
View Details
BMP3 polyclonal antibody
BS71909-02 100 µL

BMP3 polyclonal antibody

Sign In for Pricing
View Details
SNF5 (SMARCB1) (NM_001007468) Human 3' UTR Clone
SC204733 10 µg

SNF5 (SMARCB1) (NM_001007468) Human 3' UTR Clone

Sign In for Pricing
View Details
CD98 (SLC3A2) (NM_001012662) Human Recombinant Protein
TP720445XL 1 mg

CD98 (SLC3A2) (NM_001012662) Human Recombinant Protein

Sign In for Pricing
View Details
CLVS1 Protein Vector (Rat) (pPB-C-His)
PV260646 500 ng

CLVS1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ATOX1 (NM_004045) Human Tagged Lenti ORF Clone
RC221067L1 10 µg

ATOX1 (NM_004045) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details