Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8DY84

Expression Region

24-310

Origin

Streptococcus agalactiae serotype V

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVSVDKAGKPYGVIWNTLGVPMANLITYFAQHQGLGFGVAIIIVTVIVRVVILPLGLYQS WKASYQAEKMAYFKPLFEPINERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPL LIQMPFFSAIFFAARYTPGVSSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQ RQQMKTMMYLMPIMMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEY TKNPPKAYKANNARKDVTNSTKATESNQAIITSKKTNRNAGKQKRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTGF (Connective Tissue Growth Factor, CCN2, Hcs24, Hypertrophic Chondrocyte-specific Gene Product 24, IGFBP8, Insulin-like Growth Factor-Binding Protein 8) discontinued, see C7978-25F
C7978-25C-01 50 µg

CTGF (Connective Tissue Growth Factor, CCN2, Hcs24, Hypertrophic Chondrocyte-specific Gene Product 24, IGFBP8, Insulin-like Growth Factor-Binding Protein 8) discontinued, see C7978-25F

Sign In for Pricing
View Details
CTGF (Connective Tissue Growth Factor, CCN2, Hcs24, Hypertrophic Chondrocyte-specific Gene Product 24, IGFBP8, Insulin-like Growth Factor-Binding Protein 8) discontinued, see C7978-25F
C7978-25C-02 100 µg

CTGF (Connective Tissue Growth Factor, CCN2, Hcs24, Hypertrophic Chondrocyte-specific Gene Product 24, IGFBP8, Insulin-like Growth Factor-Binding Protein 8) discontinued, see C7978-25F

Sign In for Pricing
View Details
pCHA-VRC01-scFv Plasmid
PVT60468 2 µg

pCHA-VRC01-scFv Plasmid

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF488A conjugate, 0.1mg/mL
BNC881860-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Laminin Alpha 3 (LAMa3)
MBS2062784-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Laminin Alpha 3 (LAMa3)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Laminin Alpha 3 (LAMa3)
MBS2062784-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Laminin Alpha 3 (LAMa3)

Sign In for Pricing
View Details