Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8DY84

Expression Region

24-310

Origin

Streptococcus agalactiae serotype V

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVSVDKAGKPYGVIWNTLGVPMANLITYFAQHQGLGFGVAIIIVTVIVRVVILPLGLYQS WKASYQAEKMAYFKPLFEPINERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPL LIQMPFFSAIFFAARYTPGVSSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQ RQQMKTMMYLMPIMMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEY TKNPPKAYKANNARKDVTNSTKATESNQAIITSKKTNRNAGKQKRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctla2b (NM_007797) Mouse Tagged ORF Clone
MR217059 10 µg

Ctla2b (NM_007797) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
VPS13B sgRNA CRISPR Lentivector set (Human)
K2617601 3x 1.0 µg

VPS13B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Nfatc4 (NM_001107264) Rat Tagged ORF Clone
RR213834 10 µg

Nfatc4 (NM_001107264) Rat Tagged ORF Clone

Sign In for Pricing
View Details
mmu-miR-26b-3p miRNA Mimic
MBS8301055-01 5 nmol

mmu-miR-26b-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-26b-3p miRNA Mimic
MBS8301055-02 10 nmol

mmu-miR-26b-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-26b-3p miRNA Mimic
MBS8301055-03 5x 10 nmol

mmu-miR-26b-3p miRNA Mimic

Sign In for Pricing
View Details